Recombinant Full Length Human LY86 Protein, Flag-tagged

• Cat.No.: LY86-1213H
• Product Overview: Recombinant Full Length Human LY86 Protein, Flag-tagged,expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293
• Tag: Flag
• Protein Length: 1-162 aa
• Description: May cooperate with CD180 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS) and cytokine production. Important for efficient CD180 cell surface expression (By similarity).
• Tag: Flag
• Molecular Mass: 17.7 kDa
• AA Sequence: MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRF
  GIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQV
  LLELYTEKRSTVACANATIMCSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80°C.
• Concentration: >0.05 μg/μL as determined by microplate BCA method
• Storage Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol

Gene Information

• Gene Name: LY86 lymphocyte antigen 86 [ Homo sapiens (human) ]
• Official Symbol: LY86
• Synonyms: dJ80N2.1; MD-1; MD1; MMD-1;LY86
• Gene ID: 9450
• mRNA Refseq: NM_004271
• Protein Refseq: NP_004262
• MIM: 605241
• UniProt ID: O95711