Recombinant Full Length Human LUC7L3 Protein, GST-tagged

Cat.No. : LUC7L3-2091HF
Product Overview : Human CROP full-length ORF ( AAH56409.1, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 79 amino acids
Description : This gene encodes a protein with an N-terminal half that contains cysteine/histidine motifs and leucine zipper-like repeats, and the C-terminal half is rich in arginine and glutamate residues (RE domain) and arginine and serine residues (RS domain). This protein localizes with a speckled pattern in the nucleus, and could be involved in the formation of splicesome via the RE and RS domains. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2009]
Molecular Mass : 35.6 kDa
AA Sequence : MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLDVFGRGDNISDVSKFLEDDKWMEE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LUC7L3 LUC7 like 3 pre-mRNA splicing factor [ Homo sapiens (human) ]
Official Symbol LUC7L3
Synonyms LUC7L3; LUC7 like 3 pre-mRNA splicing factor; LUC7 Like 3 Pre-MRNA Splicing Factor; Cisplatin Resistance-Associated-Overexpressed Protein; Okadaic Acid-Inducible Phosphoprotein OA48-18; CAMP Regulatory Element-Associated Protein 1; CRE-Associated Protein 1; CREAP-1; LUC7A; CROP; Cisplatin Resistance Associated Overexpressed Protein; LUC7-Like 3 Pre-MRNA Splicing Factor; LUC7-Like 3 (S. Cerevisiae); CRE-Associated Protein; Luc7-Like Protein 3; LUC7-Like 3; OA48-18; HLuc7A; CREAP1; CRA; O48; luc7-like protein 3; CRE-associated protein 1; LUC7-like 3; cAMP regulatory element-associated protein 1; cisplatin resistance-associated-overexpressed protein; okadaic acid-inducible phosphoprotein OA48-18
Gene ID 51747
mRNA Refseq NM_001330330
Protein Refseq NP_001317259
MIM 609434
UniProt ID O95232

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LUC7L3 Products

Required fields are marked with *

My Review for All LUC7L3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon