Recombinant Full Length Human LRRN1 Protein, C-Flag-tagged

• Cat.No.: LRRN1-17HFL
• Product Overview: Recombinant Full Length Human LRRN1 Protein, fused to Flag-tag at C-terminus, was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293
• Tag: Flag
• Description: Predicted to act upstream of or within positive regulation of synapse assembly. Predicted to be integral component of membrane. Predicted to be active in extracellular matrix and extracellular space.
• Form: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol.
• Molecular Mass: 80.5 kDa
• AA Sequence: MARMSFVIAACQLVLGLLMTSLTESSIQNSECPQLCVCEIRPWFTPQSTYREATTVDCNDLRLTRIPSNLSSDTQVLLLQSNNIAKTVDELQQLFNLTELDFSQNNFTNIKEVGLANLTQLTTLHLEENQITEMTDYCLQDLSNLQELYINHNQISTISAHAFAGLKNLLRLHLNSNKLKVIDSRWFDSTPNLEILMIGENPVIGILDMNFKPLANLRSLVLAGMYLTDIPGNALVGLDSLESLSFYDNKLVKVPQLALQKVPSLKFLDLNKNPIHKIQEGDFKNMLRLKELGINNMGELVSVDRYALDNLPELTKLEATNNPKLSYIHRLAFRSVPALESLMLNNNALNAIYQKTVESLPNLREISIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMPPEYKGHQVKEVLIQDSSEQCLPMISHDSFPNRLNVDIGTTVFLDCRAMAEPEPEIYWVTPIGNKITVETLSDKYKLSSEGTLEISNIQIEDSGRYTCVAQNVQGADTRVATIKVNGTLLDGTQVLKIYVKQTESHSILVSWKVNSNVMTSNLKWSSATMKIDNPHITYTARVPVDVHEYNLTHLQPSTDYEVCLTVSNIHQQTQKSCVNVTTKNAAFAVDISDQETSTALAAVMGSMFAVISLASIAVYFAKRFKRKNYHHSLKKYMQKTSSIPLNELYPPLINLWEGDSEKDKDGSADTKPTQVDTSRSYYMW myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80 centigrade.
• Concentration: >0.05 μg/μL as determined by microplate BCA method.
• Use/Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: LRRN1 leucine rich repeat neuronal 1 [ Homo sapiens (human) ]
• Official Symbol: LRRN1
• Synonyms: LRRN1; FIGLER3; NLRR-1; NLRR1; leucine rich repeat neuronal 1
• Gene ID: 57633
• mRNA Refseq: NM_020873.7
• Protein Refseq: NP_065924.3
• MIM: 619623
• UniProt ID: Q6UXK5