Recombinant Full Length Human LRRC55 Protein, GST-tagged

• Cat.No.: LRRC55-6060HF
• Product Overview: Human LRRC55 full-length ORF ( NP_001005210.1, 1 a.a. - 341 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: LRRC55 (Leucine Rich Repeat Containing 55) is a Protein Coding gene. An important paralog of this gene is LRRC38.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 64 kDa
• Protein length: 341 amino acids
• AA Sequence: MLRSPTFTDAGPRCSCLPVSQTLDSMDTVLMGSLQHCCCLLPKMGDTWAQLPWPGPPHPAMLLISLLLAAGLMHSDAGTSCPVLCTCRNQVVDCSSQRLFSVPPDLPMDTRNLSLAHNRITAVPPGYLTCYMELQVLDLHNNSLMELPRGLFLHAKRLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQLAECRGPPEVEGAPLFSLTEESFKACHLTLTLDDYLFIAFVGFVVSIASVATNFLLGITANCCHRWSKASEEEEI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LRRC55 leucine rich repeat containing 55 [ Homo sapiens ]
• Official Symbol: LRRC55
• Synonyms: LRRC55; leucine rich repeat containing 55
• Gene ID: 219527
• mRNA Refseq: NM_001005210
• Protein Refseq: NP_001005210
• MIM: 615213
• UniProt ID: Q6ZSA7