Recombinant Full Length Human LIPG Protein, C-Flag-tagged
Cat.No. : | LIPG-183HFL |
Product Overview : | Recombinant Full Length Human LIPG Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.6 kDa |
AA Sequence : | MSNSVPLLCFWSLCYCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPEHEGCYLSVG HSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNT RVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFEGADIHKR LSPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQPGCGLNDVLGSIAYGTITEVVKCEHER AVHLFVDSLVNQDKPSFAFQCTDSNRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFR VYHYQMKIHVFSYKNMGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLVYTEEDLGDLLKIQL TWEGASQSWYNLWKEFRSYLSQPRNPGRELNIRRIRVKSGETQRKLTFCTEDPENTSISPGQELWFRKC RDGWRMKNETSPTVELPSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Protein Pathways : | Glycerolipid metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | LIPG lipase G, endothelial type [ Homo sapiens (human) ] |
Official Symbol | LIPG |
Synonyms | EL; EDL; PRO719 |
Gene ID | 9388 |
mRNA Refseq | NM_006033.4 |
Protein Refseq | NP_006024.1 |
MIM | 603684 |
UniProt ID | Q9Y5X9 |
◆ Recombinant Proteins | ||
LIPG-1639H | Recombinant Human LIPG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LIPG-45H | Recombinant Human LIPG Protein, His-tagged | +Inquiry |
LIPG-3075R | Recombinant Rat LIPG Protein, His (Fc)-Avi-tagged | +Inquiry |
Lipg-30R | Recombinant Rat Lipg protein, His-tagged | +Inquiry |
Lipg-698M | Recombinant Mouse Lipg Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIPG-4724HCL | Recombinant Human LIPG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LIPG Products
Required fields are marked with *
My Review for All LIPG Products
Required fields are marked with *
0
Inquiry Basket