Recombinant Full Length Human Lipase Maturation Factor 1(Lmf1) Protein, His-Tagged
Cat.No. : | RFL924HF |
Product Overview : | Recombinant Full Length Human Lipase maturation factor 1(LMF1) Protein (Q96S06) (1-567aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-567) |
Form : | Lyophilized powder |
AA Sequence : | MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFWLTRIVLLKAL AFVYFVAFLVAFHQNKQLIGDRGLLPCRVFLKNFQQYFQDRTSWEVFSYMPTILWLMDWS DMNSNLDLLALLGLGISSFVLITGCANMLLMAALWGLYMSLVNVGHVWYSFGWESQLLET GFLGIFLCPLWTLSRLPQHTPTSRIVLWGFRWLIFRIMLGAGLIKIRGDRCWRDLTCMDF HYETQPMPNPVAYYLHHSPWWFHRFETLSNHFIELLVPFFLFLGRRACIIHGVLQILFQA VLIVSGNLSFLNWLTMVPSLACFDDATLGFLFPSGPGSLKDRVLQMQRDIRGARPEPRFG SVVRRAANVSLGVLLAWLSVPVVLNLLSSRQVMNTHFNSLHIVNTYGAFGSITKERAEVI LQGTASSNASAPDAMWEDYEFKCKPGDPSRRPCLISPYHYRLDWLMWFAAFQTYEHNDWI IHLAGKLLASDAEALSLLAHNPFAGRPPPRWVRGEHYRYKFSRPGGRHAAEGKWWVRKRI GAYFPPLSLEELRPYFRDRGWPLPGPL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LMF1 |
Synonyms | LMF1; C16orf26; TMEM112; HMFN1876; JFP11; Lipase maturation factor 1; Transmembrane protein 112 |
UniProt ID | Q96S06 |
◆ Recombinant Proteins | ||
Il27ra-5789M | Recombinant Mouse Il27ra protein, His & T7-tagged | +Inquiry |
RANBP1-301411H | Recombinant Human RANBP1 protein, GST-tagged | +Inquiry |
DsRed-5642s | Recombinant synthetic construct DsRed Protein (Leu3-Arg230), N-6×HN tagged | +Inquiry |
AHCYL2-5643H | Recombinant Human AHCYL2 protein, GST-tagged | +Inquiry |
RFL420BF | Recombinant Full Length Bovine Pra1 Family Protein 3(Arl6Ip5) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Troponin-16R | Native Rabbit Skeletal Muscle Troponin ITC Complex | +Inquiry |
a-Actinin-855C | Native Porcine a-Actinin Protein | +Inquiry |
APOC3-669H | Native Human APOC3 protein | +Inquiry |
Chylomicrons-192H | Native Human Chylomicrons | +Inquiry |
ASOM-37 | Active Native L-ascorbate oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITPRIPL1-5110HCL | Recombinant Human ITPRIPL1 293 Cell Lysate | +Inquiry |
LRRFIP2-1034HCL | Recombinant Human LRRFIP2 cell lysate | +Inquiry |
Colon-87P | Porcine Colon Lysate | +Inquiry |
GGT6-701HCL | Recombinant Human GGT6 cell lysate | +Inquiry |
HOP92-049WCY | Human Non-small Cell Lung Adenocarcinoma HOP92 Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All LMF1 Products
Required fields are marked with *
My Review for All LMF1 Products
Required fields are marked with *
0
Inquiry Basket