Recombinant Full Length Human LILRA1 Protein, C-Flag-tagged
Cat.No. : | LILRA1-1117HFL |
Product Overview : | Recombinant Full Length Human LILRA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an activating member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein is predominantly expressed in B cells, interacts with major histocompatibility complex class I ligands, and contributes to the regulation of immune responses. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53.1 kDa |
AA Sequence : | MTPIVTVLICLRLSLGPRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWI TRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGN VTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSL PSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQA NFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWG PFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVS GAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVENLIRMGIAGLVLVVLGILLFEAQHSQRSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | LILRA1 leukocyte immunoglobulin like receptor A1 [ Homo sapiens (human) ] |
Official Symbol | LILRA1 |
Synonyms | LIR6; CD85I; LIR-6 |
Gene ID | 11024 |
mRNA Refseq | NM_006863.4 |
Protein Refseq | NP_006854.1 |
MIM | 604810 |
UniProt ID | O75019 |
◆ Recombinant Proteins | ||
LILRA1-1295H | Recombinant Human LILRA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LILRA1-267H | Active Recombinant Human LILRA1 protein, His-tagged | +Inquiry |
LILRA1-721H | Active Recombinant Human LILRA1 Protein, His-Avi-tagged, Biotinylated | +Inquiry |
LILRA1-719H | Recombinant Human LILRA1 protein (Met1-Asn446), His-tagged | +Inquiry |
LILRA1-1117HFL | Recombinant Full Length Human LILRA1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRA1-4744HCL | Recombinant Human LILRA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LILRA1 Products
Required fields are marked with *
My Review for All LILRA1 Products
Required fields are marked with *
0
Inquiry Basket