Recombinant Full Length Human LIG3 Protein, C-Flag-tagged
Cat.No. : | LIG3-599HFL |
Product Overview : | Recombinant Full Length Human LIG3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the DNA ligase family. Each member of this family encodes a protein that catalyzes the joining of DNA ends but they each have a distinct role in DNA metabolism. The protein encoded by this gene is involved in excision repair and is located in both the mitochondria and nucleus, with translation initiation from the upstream start codon allowing for transport to the mitochondria and translation initiation from a downstream start codon allowing for transport to the nucleus. Additionally, alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 108.6 kDa |
AA Sequence : | MSLAFKIFFPQTLRALSRKELCLFRKHHWRDVRQFSQWSETDLLHGHPLFLRRKPVLSFQGSHLRSRATY LVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIGKVVPNPFSESGGDMKEWYHI KCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQHIADLSSKAAGTPKKKAVVQAKLTTTGQVTS PVKGASFVTSTNPRKFSGFSAKPNNSGEAPSSPTPKRSLSSSKCDPRHKDCLLREFRKLCAMVADNPSYN TKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDV SETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDL KMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQEVEKEPGQRRALSVQASLMTPVQPMLAEACK SVEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAHFKDYIPQAFPGGHSMILDSE VLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYFNDVSLMDRPLCERRKFLHDNMVEIPNRIMF SEMKRVTKALDLADMITRVIQEGLEGLVLKDVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYG QGSKGGMMSIFLMGCYDPGSQKWCTVTKCAGGHDDATLARLQNELDMVKISKDPSKIPSWLKVNKIYYPD FIVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTV VAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPSAMKVGEKLAT KSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEFDMTSATHVLG SRDKNPAAQQVSPEWIWACIRKRRLVAPCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Base excision repair |
Full Length : | Full L. |
Gene Name | LIG3 DNA ligase 3 [ Homo sapiens (human) ] |
Official Symbol | LIG3 |
Synonyms | LIG2; MTDPS20; LIG3alpha |
Gene ID | 3980 |
mRNA Refseq | NM_013975.4 |
Protein Refseq | NP_039269.2 |
MIM | 600940 |
UniProt ID | P49916 |
◆ Recombinant Proteins | ||
ICOSLG-7689H | Recombinant Human ICOSLG protein, His & T7-tagged | +Inquiry |
CPT1C-2231HF | Recombinant Full Length Human CPT1C Protein, GST-tagged | +Inquiry |
GINS3-1853R | Recombinant Rhesus monkey GINS3 Protein, His-tagged | +Inquiry |
PDIA3-1637H | Recombinant Human PDIA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Defb6-5332M | Recombinant Mouse Defb6 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
BLA-01B | Native Bovine β-Lactoglobulin Protein | +Inquiry |
INS-512D | Native Bovine INS | +Inquiry |
Collagen-01B | Native Bovine Type II Collagen | +Inquiry |
TF-47C | Native Cattle Transferrin (TRF) Protein | +Inquiry |
KLK4-239R | Native Rat Kallikrein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCMH1-2033HCL | Recombinant Human SCMH1 293 Cell Lysate | +Inquiry |
CNDP1-1580MCL | Recombinant Mouse CNDP1 cell lysate | +Inquiry |
HAT1-5631HCL | Recombinant Human HAT1 293 Cell Lysate | +Inquiry |
FABP6-6475HCL | Recombinant Human FABP6 293 Cell Lysate | +Inquiry |
TADA1-650HCL | Recombinant Human TADA1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All LIG3 Products
Required fields are marked with *
My Review for All LIG3 Products
Required fields are marked with *
0
Inquiry Basket