Recombinant Full Length Human KLRD1 Protein

• Cat.No.: KLRD1-267HF
• Product Overview: Recombinant full length Human CD94 with N-terminal proprietary tag. Predicted MW 45.1kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 179 amino acids
• Description: Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Three transcript variants encoding two different isoforms have been found for this gene.
• Form: Liquid
• Molecular Mass: 45.100kDa inclusive of tags
• AA Sequence: MAVFKTTLWRLISGTLGIICLSLMATLGILLKNSFTKLSI EPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQK TWNESRHLCASQKSSLLQLQNTDELDFMSSSRQFYWIGLS YSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGN ALDESCEDKNRYICKQQLI
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: KLRD1 killer cell lectin-like receptor subfamily D, member 1 [ Homo sapiens ]
• Official Symbol: KLRD1
• Synonyms: KLRD1; killer cell lectin-like receptor subfamily D, member 1; CD94; natural killer cells antigen CD94
• Gene ID: 3824
• mRNA Refseq: NM_001114396
• Protein Refseq: NP_001107868
• MIM: 602894
• UniProt ID: Q13241