Recombinant Full Length Human KLK8 Protein, GST-tagged
Cat.No. : | KLK8-5867HF |
Product Overview : | Human KLK8 full-length ORF ( NP_009127.1, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 260 amino acids |
Description : | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in four transcript variants encoding four different isoforms. The isoforms exhibit distinct patterns of expression that suggest roles in brain plasticity and ovarian cancer. [provided by RefSeq |
Molecular Mass : | 54.4 kDa |
AA Sequence : | MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KLK8 kallikrein-related peptidase 8 [ Homo sapiens ] |
Official Symbol | KLK8 |
Synonyms | KLK8; kallikrein-related peptidase 8; kallikrein 8 (neuropsin/ovasin) , PRSS19; kallikrein-8; HNP; neuropsin; ovasin; TADG14; hK8; neuropsin type 1; neuropsin type 2; serine protease 19; KLK8 protein type 1; KLK8 protein type 2; serine protease TADG-14; tumor-associated differentially expressed gene 14 protein; NP; NRPN; PRSS19; |
Gene ID | 11202 |
mRNA Refseq | NM_007196 |
Protein Refseq | NP_009127 |
MIM | 605644 |
UniProt ID | O60259 |
◆ Recombinant Proteins | ||
KLK8-797H | Recombinant Human KLK8 protein, His & T7-tagged | +Inquiry |
Klk8-3727M | Recombinant Mouse Klk8 Protein, Myc/DDK-tagged | +Inquiry |
KLK8-998H | Active Recombinant Human KLK8 Protein, His-tagged | +Inquiry |
KLK8-4928H | Recombinant Human KLK8 Protein, GST-tagged | +Inquiry |
KLK8-688H | Recombinant Human KLK8 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK8-1985HCL | Recombinant Human KLK8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KLK8 Products
Required fields are marked with *
My Review for All KLK8 Products
Required fields are marked with *
0
Inquiry Basket