Recombinant Full Length Human KLC2 Protein, C-Flag-tagged
Cat.No. : | KLC2-1945HFL |
Product Overview : | Recombinant Full Length Human KLC2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a light chain of kinesin, a molecular motor responsible for moving vesicles and organelles along microtubules. Defects in this gene are a cause of spastic paraplegia, optic atrophy, and neuropathy (SPOAN) syndrome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 68.8 kDa |
AA Sequence : | MAMMVFPREEKLSQDEIVLGTKAVIQGLETLRGEHRALLAPLVAPEAGEAEPGSQERCILLRRSLEAIEL GLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFM SQIRKLDEDASPNEEKGDVPKDTLDDLFPNEDEQSPAPSPGGGDVSGQHGGYEIPARLRTLHNLVIQYAS QGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPA VAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEEVEYYYRRA LEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREE SKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCASRNRKQGLDPASQTK VVELLKDGSGRRGDRRSSRDMAGGAGPRSESDLEDVGPTAEWNGDGSGSLRRSGSFGKLRDALRRSSEML VKKLQGGTPQEPPNPRMKRASSLNFLNKSVEEPTQPGGTGLSDSRTLSSSSMDLSRRSSLVG myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | KLC2 kinesin light chain 2 [ Homo sapiens (human) ] |
Official Symbol | KLC2 |
Synonyms | SPOAN |
Gene ID | 64837 |
mRNA Refseq | NM_001134775.2 |
Protein Refseq | NP_001128247.1 |
MIM | 611729 |
UniProt ID | Q9H0B6 |
◆ Recombinant Proteins | ||
KLC2-1249H | Recombinant Human KLC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLC2-2231R | Recombinant Rhesus Macaque KLC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLC2-5632H | Recombinant Human KLC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KLC2-391H | Recombinant Human KLC2, GST-tagged | +Inquiry |
KLC2-625H | Recombinant Human KLC2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLC2-4934HCL | Recombinant Human KLC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KLC2 Products
Required fields are marked with *
My Review for All KLC2 Products
Required fields are marked with *
0
Inquiry Basket