Recombinant Full Length Human KIF20A Protein, C-Flag-tagged
Cat.No. : | KIF20A-1366HFL |
Product Overview : | Recombinant Full Length Human KIF20A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables protein kinase binding activity. Involved in microtubule bundle formation; midbody abscission; and regulation of cytokinesis. Located in several cellular components, including cleavage furrow; intercellular bridge; and midbody. Implicated in restrictive cardiomyopathy. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 100.1 kDa |
AA Sequence : | MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLR VRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHRFTFSQIFGPEVGQASFFNLT VKEMVKDVLKGQNWLIYTYGVTNSGKTHTIQGTIKDGGILPRSLALIFNSLQGQLHPTPDLKPLLSNEVI WLDSKQIRQEEMKKLSLLNGGLQEEELSTSLKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDETS HRWAQPDTAPLPVPANIRFSIWISFFEIYNELLYDLLEPPSQQRKRQTLRLCEDQNGNPYVKDLNWIHVQ DAEEAWKLLKVGRKNQSFASTHLNQNSSRSHSIFSIRILHLQGEGDIVPKISELSLCDLAGSERCKDQKS GERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLVPFRDSKLTRVFQGFFTGRGRSCMIVNVNPCAST YDETLHVAKFSAIASQLVHAPPMQLGFPSLHSFIKEHSLQVSPSLEKGAKADTGLDDDIENEADISMYGK EELLQVVEAMKTLLLKERQEKLQLEMHLRDEICNEMVEQMQQREQWCSEHLDTQKELLEEMYEEKLNILK ESLTSFYQEEIQERDEKIEELEALLQEARQQSVAHQQSGSELALRRSQRLAASASTQQLQEVKAKLQQCK AELNSTTEELHKYQKMLEPPPSAKPFTIDVDKKLEEGQKNIRLLRTELQKLGESLQSAERACCHSTGAGK LRQALTTCDDILIKQDQTLAELQNNMVLVKLDLRKKAACIAEQYHTVLKLQGQVSAKKRLGTNQENQQPN QQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRRSPLLKSGPFGKKYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | KIF20A kinesin family member 20A [ Homo sapiens (human) ] |
Official Symbol | KIF20A |
Synonyms | RCM6; MKLP2; RAB6KIFL |
Gene ID | 10112 |
mRNA Refseq | NM_005733.3 |
Protein Refseq | NP_005724.1 |
MIM | 605664 |
UniProt ID | O95235 |
◆ Recombinant Proteins | ||
SE0102-3069S | Recombinant Staphylococcus epidermidis ATCC 12228 SE0102 protein, His-tagged | +Inquiry |
RPL8-3995R | Recombinant Rhesus monkey RPL8 Protein, His-tagged | +Inquiry |
MYBL2-6653HF | Recombinant Full Length Human MYBL2 Protein, GST-tagged | +Inquiry |
GTPBP3-2750R | Recombinant Rat GTPBP3 Protein | +Inquiry |
FASTKD3-12757H | Recombinant Human FASTKD3, His-tagged | +Inquiry |
◆ Native Proteins | ||
HSV2-16 | Native Herpes Simplex Virus (HSV) Type 2 Antigen | +Inquiry |
F13-53H | Active Native Human Coagulation Factor XIII, Alexa Fluor 700 Conjugated | +Inquiry |
Adv2-10 | Native Adenovirus Type 2 Hexon Antigen | +Inquiry |
FGG -36D | Native Canine Fibrinogen | +Inquiry |
Lectin-1734U | Active Native Ulex Europaeus Agglutinin I Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
Spleen-476H | Human Spleen Membrane Lysate | +Inquiry |
MARVELD2-4462HCL | Recombinant Human MARVELD2 293 Cell Lysate | +Inquiry |
APTX-103HCL | Recombinant Human APTX cell lysate | +Inquiry |
IL2RB-2906HCL | Recombinant Human IL2RB cell lysate | +Inquiry |
DPP9-6828HCL | Recombinant Human DPP9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KIF20A Products
Required fields are marked with *
My Review for All KIF20A Products
Required fields are marked with *
0
Inquiry Basket