Recombinant Full Length Human KDSR Protein, C-Flag-tagged
Cat.No. : | KDSR-1045HFL |
Product Overview : | Recombinant Full Length Human KDSR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine. The putative active site residues of the encoded protein are found on the cytosolic side of the endoplasmic reticulum membrane. A chromosomal rearrangement involving this gene is a cause of follicular lymphoma, also known as type II chronic lymphatic leukemia. The mutation of a conserved residue in the bovine ortholog causes spinal muscular atrophy. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 33.4 kDa |
AA Sequence : | MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLL QAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFER LMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVY ITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCG MAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQREKSENADKTATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Metabolic pathways, Sphingolipid metabolism |
Full Length : | Full L. |
Gene Name | KDSR 3-ketodihydrosphingosine reductase [ Homo sapiens (human) ] |
Official Symbol | KDSR |
Synonyms | DHSR; FVT1; EKVP4; SDR35C1 |
Gene ID | 2531 |
mRNA Refseq | NM_002035.4 |
Protein Refseq | NP_002026.1 |
MIM | 136440 |
UniProt ID | Q06136 |
◆ Recombinant Proteins | ||
KDSR-410H | Recombinant Human KDSR Protein, MYC/DDK-tagged | +Inquiry |
Kdsr-3685M | Recombinant Mouse Kdsr Protein, Myc/DDK-tagged | +Inquiry |
KDSR-8601M | Recombinant Mouse KDSR Protein | +Inquiry |
KDSR-2683C | Recombinant Chicken KDSR | +Inquiry |
RFL494BF | Recombinant Full Length Bovine 3-Ketodihydrosphingosine Reductase(Kdsr) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDSR-356HCL | Recombinant Human KDSR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KDSR Products
Required fields are marked with *
My Review for All KDSR Products
Required fields are marked with *
0
Inquiry Basket