Recombinant Full Length Human ISM1 Protein, C-Flag-tagged
Cat.No. : | ISM1-1921HFL |
Product Overview : | Recombinant Full Length Human ISM1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to be involved in negative regulation of angiogenesis. Predicted to be located in extracellular region. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 51.9 kDa |
AA Sequence : | MVRLAAELLLLLGLLLLTLHITVLRGSGAADGPDAAAGNASQAQLQNNLNVGSDTTSETSFSLSKEAPRE HLDHQAAHQPFPRPRFRQETGHPSLQRDFPRSFLLDLPNFPDLSKADINGQNPNIQVTIEVVDGPDSEAD KDQHPENKPSWSVPSPDWRAWWQRSLSLARANSGDQDYKYDSTSDDSNFLNPPRGWDHTAPGHRTFETKD QPEYDSTDGEGDWSLWSVCSVTCGNGNQKRTRSCGYACTATESRTCDRPNCPGIEDTFRTAATEVSLLAG SEEFNATKLFEVDTDSCERWMSCKSEFLKKYMHKVMNDLPSCPCSYPTEVAYSTADIFDRIKRKDFRWKD ASGPKEKLEIYKPTARYCIRSMLSLESTTLAAQHCCYGDNMQLITRGKGAGTPNLISTEFSAELHYKVDV LPWIICKGDWSRYNEARPPNNGQKCTESPSDEDYIKQFQEAREY SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | ISM1 isthmin 1 [ Homo sapiens (human) ] |
Official Symbol | ISM1 |
Synonyms | ISM; Isthmin; C20orf82; bA149I18.1; dJ1077I2.1 |
Gene ID | 140862 |
mRNA Refseq | NM_080826.2 |
Protein Refseq | NP_543016.1 |
MIM | 615793 |
UniProt ID | B1AKI9 |
◆ Recombinant Proteins | ||
ISM1-4210H | Recombinant Human ISM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ISM1-4623M | Recombinant Mouse ISM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ISM1-2031Z | Recombinant Zebrafish ISM1 | +Inquiry |
Ism1-12M | Recombinant Mouse Ism1 Protein (30-461), C-His-tagged | +Inquiry |
ISM1-2619H | Recombinant Human ISM1 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ISM1 Products
Required fields are marked with *
My Review for All ISM1 Products
Required fields are marked with *
0
Inquiry Basket