Recombinant Full Length Human IRF2 Protein, C-Flag-tagged
Cat.No. : | IRF2-2064HFL |
Product Overview : | Recombinant Full Length Human IRF2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.2 kDa |
AA Sequence : | MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVD KPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEP VESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESD EQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASF VTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | IRF2 interferon regulatory factor 2 [ Homo sapiens (human) ] |
Official Symbol | IRF2 |
Synonyms | IRF-2 |
Gene ID | 3660 |
mRNA Refseq | NM_002199.4 |
Protein Refseq | NP_002190.2 |
MIM | 147576 |
UniProt ID | P14316 |
◆ Recombinant Proteins | ||
IRF2-5044H | Recombinant Human IRF2 Protein, GST-tagged | +Inquiry |
IRF2-2294R | Recombinant Rhesus monkey IRF2 Protein, His-tagged | +Inquiry |
IRF2-2115R | Recombinant Rhesus Macaque IRF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
IRF2-4599M | Recombinant Mouse IRF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
IRF2-5499H | Recombinant Human IRF2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF2-5167HCL | Recombinant Human IRF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IRF2 Products
Required fields are marked with *
My Review for All IRF2 Products
Required fields are marked with *
0
Inquiry Basket