Recombinant Full Length Human IPMK Protein, C-Flag-tagged
Cat.No. : | IPMK-272HFL |
Product Overview : | Recombinant Full Length Human IPMK Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the inositol phosphokinase family. The encoded protein has 3-kinase, 5-kinase and 6-kinase activities on phosphorylated inositol substrates. The encoded protein plays an important role in the biosynthesis of inositol 1,3,4,5,6-pentakisphosphate, and has a preferred 5-kinase activity. This gene may play a role in nuclear mRNA export. Pseudogenes of this gene are located on the long arm of chromosome 13 and the short arm of chromosome 19. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 47 kDa |
AA Sequence : | MATEPPSPLRVEAPGPPEMRTSPAIESTPEGTPQPAGGRLRFLNGCVPLSHQVAGHMYGKDKVGILQHPD GTVLKQLQPPPRGPRELEFYNMVYAADCFDGVLLELRKYLPKYYGIWSPPTAPNDLYLKLEDVTHKFNKP CIMDVKIGQKSYDPFASSEKIQQQVSKYPLMEEIGFLVLGMRVYHVHSDSYETENQHYGRSLTKETIKDG VSRFFHNGYCLRKDAVAASIQKIEKILQWFENQKQLNFYASSLLFVYEGSSQPTTTKLNDRTLAEKFLSK GQLSDTEVLEYNNNFHVLSSTANGKIESSVGKSLSKMYARHRKIYTKKHHSQTSLKVENLEQDNGWKSMS QEHLNGNVLSQLEKVFYHLPTGCQEIAEVEVRMIDFAHVFPSNTIDEGYVYGLKHLISVLRSILDNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Inositol phosphate metabolism |
Full Length : | Full L. |
Gene Name | IPMK inositol polyphosphate multikinase [ Homo sapiens (human) ] |
Official Symbol | IPMK |
Synonyms | Impk; inositol polyphosphate kinase 2; inositol polyphosphate multikinase; Ipk2 |
Gene ID | 253430 |
mRNA Refseq | NM_152230.5 |
Protein Refseq | NP_689416.1 |
MIM | 609851 |
UniProt ID | Q8NFU5 |
◆ Recombinant Proteins | ||
IPMK-5688HF | Recombinant Full Length Human IPMK Protein, GST-tagged | +Inquiry |
IPMK-3087R | Recombinant Rat IPMK Protein | +Inquiry |
IPMK-8260M | Recombinant Mouse IPMK Protein | +Inquiry |
IPMK-705H | Recombinant Human IPMK Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IPMK-1191H | Recombinant Human IPMK Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IPMK-866HCL | Recombinant Human IPMK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IPMK Products
Required fields are marked with *
My Review for All IPMK Products
Required fields are marked with *
0
Inquiry Basket