Recombinant Full Length Human IL2RG Protein

• Cat.No.: IL2RG-5758HF
• Product Overview: Human IL2RG full-length ORF (NP_000197.1) recombinant protein without tag.

Specification

• Description: The interleukin 2 (IL2) receptor gamma chain (IL2RG), an important signalling component of many interleukin receptors (IL2,IL4,IL7,IL9, and IL15), is thus referred to as the common gamma chain. Mutations in this X-chromosome-linked gene cause X-linked severe combined immunodeficiency (XSCID). [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 42.3 kDa
• Protein length: 280 amino acids
• AA Sequence: MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: IL2RG interleukin 2 receptor, gamma [ Homo sapiens ]
• Official Symbol: IL2RG
• Synonyms: IL2RG; interleukin 2 receptor, gamma; CIDX, combined immunodeficiency, X linked , IMD4, SCIDX1, severe combined immunodeficiency; cytokine receptor common subunit gamma; CD132; gammaC; gamma(c); CD132 antigen; common gamma-chain; IL-2R subunit gamma; IL-2 receptor subunit gamma; severe combined immunodeficiency; combined immunodeficiency, X-linked; common cytokine receptor gamma chain; interleukin-2 receptor subunit gamma; P64; CIDX; IMD4; SCIDX; IL-2RG; SCIDX1
• Gene ID: 3561
• mRNA Refseq: NM_000206
• Protein Refseq: NP_000197
• MIM: 308380
• UniProt ID: P31785