Recombinant Full Length Human IL17RA Protein, C-Flag-tagged
Cat.No. : | IL17RA-2083HFL |
Product Overview : | Recombinant Full Length Human IL17RA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Interleukin 17A (IL17A) is a proinflammatory cytokine secreted by activated T-lymphocytes. It is a potent inducer of the maturation of CD34-positive hematopoietic precursors into neutrophils. The transmembrane protein encoded by this gene (interleukin 17A receptor; IL17RA) is a ubiquitous type I membrane glycoprotein that binds with low affinity to interleukin 17A. Interleukin 17A and its receptor play a pathogenic role in many inflammatory and autoimmune diseases such as rheumatoid arthritis. Like other cytokine receptors, this receptor likely has a multimeric structure. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 93.2 kDa |
AA Sequence : | MGAARSPPSAVPGPLLGLLLLLLGVLAPGGASLRLLDHRALVCSQPGLNCTVKNSTCLDDSWIHPRNLTP SSPKDLQIQLHFAHTQQGDLFPVAHIEWTLQTDASILYLEGAELSVLQLNTNERLCVRFEFLSKLRHHHR RWRFTFSHFVVDPDQEYEVTVHHLPKPIPDGDPNHQSKNFLVPDCEHARMKVTTPCMSSGSLWDPNITVE TLEAHQLRVSFTLWNESTHYQILLTSFPHMENHSCFEHMHHIPAPRPEEFHQRSNVTLTLRNLKGCCRHQ VQIQPFFSSCLNDCLRHSATVSCPEMPDTPEPIPDYMPLWVYWFITGISILLVGSVILLIVCMTWRLAGP GSEKYSDDTKYTDGLPVADLIPPPLKPRKVWIIYSADHPLYVDVVLKFAQFLLTACGTEVALDLLEEQAI SEAGVMTWVGRQKQEMVESNSKIIVLCSRGTRAKWQALLGRGAPVRLRCDHGKPVGDLFTAAMNMILPDF KRPACFGTYVVCYFSEVSCDGDVPDLFGAAPRYPLMDRFEEVYFRIQDLEMFQPGRMHRVGELSGDNYLR SPGGRQLRAALDRFRDWQVHCPDWFECENLYSADDQDAPSLDEEVFEEPLLPPGTGIVKRAPLVREPGSQ ACLAIDPLVGEEGGAAVAKLEPHLQPRGQPAPQPLHTLVLAAEEGALVAAVEPGPLADGAAVRLALAGEG EACPLLGSPGAGRNSVLFLPVDPEDSPLGSSTPMASPDLLPEDVREHLEGLMLSLFEQSLSCQAQGGCSR PAMVLTDPHTPYEEEQRQSVQSDQGYISRSSPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQ RQLLFRQLQKNSGWDTMGSESEGPSA myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Cytokine-cytokine receptor interaction |
Full Length : | Full L. |
Gene Name | IL17RA interleukin 17 receptor A [ Homo sapiens (human) ] |
Official Symbol | IL17RA |
Synonyms | CD217; IL17R; IMD51; CANDF5; CDw217; IL-17RA; hIL-17R |
Gene ID | 23765 |
mRNA Refseq | NM_014339.7 |
Protein Refseq | NP_055154.3 |
MIM | 605461 |
UniProt ID | Q96F46 |
◆ Recombinant Proteins | ||
IL17RA-0261H | Active Recombinant Human IL17RA protein, His-tagged | +Inquiry |
IL17RA-442R | Active Recombinant Rhesus IL17RA Protein, His-tagged | +Inquiry |
IL17RA-2199H | BiotinylatedRecombinant Human IL17RA protein(Met1-Trp320), His&hFc-tagged | +Inquiry |
IL17RA-1328M | Acitve Recombinant Mouse IL17RA protein(Met1-Trp322), hFc-tagged | +Inquiry |
IL17RA-404M | Recombinant Mouse IL17RA protein(Met1-Trp322), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17RA-2640HCL | Recombinant Human IL17RA cell lysate | +Inquiry |
IL17RA-1252CCL | Recombinant Cynomolgus IL17RA cell lysate | +Inquiry |
IL17RA-1070MCL | Recombinant Mouse IL17RA cell lysate | +Inquiry |
IL17RA-1441RCL | Recombinant Rat IL17RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL17RA Products
Required fields are marked with *
My Review for All IL17RA Products
Required fields are marked with *
0
Inquiry Basket