Recombinant Full Length Human IKBKB Protein
Cat.No. : | IKBKB-255HF |
Product Overview : | Recombinant full length Human IKK beta with N terminal proprietary tag, 53.79kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
ProteinLength : | 256 amino acids |
Description : | The protein encoded by this gene phosphorylates the inhibitor in the inhibitor/NF-kappa-B complex, causing dissociation of the inhibitor and activation of NF-kappa-B. The encoded protein itself is found in a complex of proteins. Several transcript variants, some protein-coding and some not, have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 53.790kDa inclusive of tags |
AA Sequence : | MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQ IAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVP EGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRL IHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYT VTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVA HSCNPSTLGGRGRWIS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | IKBKB inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta [ Homo sapiens ] |
Official Symbol | IKBKB |
Synonyms | IKBKB; inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta; inhibitor of nuclear factor kappa-B kinase subunit beta; IKK beta; IKK2; IKKB; NFKBIKB |
Gene ID | 3551 |
mRNA Refseq | NM_001190720 |
Protein Refseq | NP_001177649 |
MIM | 603258 |
UniProt ID | O14920 |
◆ Recombinant Proteins | ||
Was-1970R | Recombinant Rat Was protein, His & T7-tagged | +Inquiry |
CLK4-6858HF | Active Recombinant Full Length Human CLK4 Protein, GST-tagged | +Inquiry |
TTLL9-6350R | Recombinant Rat TTLL9 Protein | +Inquiry |
FOXO3-2811H | Recombinant Human FOXO3, MYC/DDK-tagged | +Inquiry |
RFL29657MF | Recombinant Full Length Mouse Vomeronasal Type-1 Receptor 54(Vmn1R54) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
F7-5303H | Native Human Coagulation Factor VII, R-PE conjugated | +Inquiry |
Lectin-1844S | Active Native Solanum Tuberosum Lectin Protein | +Inquiry |
α-Crystallin-01B | Native Bovine α-Crystallin Protein | +Inquiry |
PLAU-8456H | Active Native Human PLAU | +Inquiry |
MV-01 | Native Measles Virus Antigen (Premium) | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGFR-1621MCL | Recombinant Mouse EGFR cell lysate | +Inquiry |
NFYA-3841HCL | Recombinant Human NFYA 293 Cell Lysate | +Inquiry |
ANXA8-1023HCL | Recombinant Human ANXA8 cell lysate | +Inquiry |
AKR1B10-8931HCL | Recombinant Human AKR1B10 293 Cell Lysate | +Inquiry |
IFNGR1-1003CCL | Recombinant Cynomolgus IFNGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IKBKB Products
Required fields are marked with *
My Review for All IKBKB Products
Required fields are marked with *
0
Inquiry Basket