Recombinant Full Length Human IFTAP Protein, GST-tagged

• Cat.No.: IFTAP-1879HF
• Product Overview: Human IFTAP full-length ORF ( NP_620142.2, 1 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 221 amino acids
• Description: This gene encodes a protein that was identified as a cellular interacting partner of non-structural protein 10 of the severe acute respiratory syndrome coronavirus (SARS-CoV). The encoded protein may function as a negative regulator of transcription. There is a pseudogene for this gene on chromosome 1. Alternative splicing results in multiple transcript variants.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 51.8 kDa
• AA Sequence: MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSENIFTSAKVTHKNEADDYHLRNKTIFLRTSSQCLEEQVDNFLDLEDLDMDEEIKPQMSEDLLLLPGEVEQDVSTSIPSCIPFVAQPPTCEVKPKPSVKRMDKQTEEILGDEVQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IFTAP intraflagellar transport associated protein [ Homo sapiens (human) ]
• Official Symbol: IFTAP
• Synonyms: C11ORF74; chromosome 11 open reading frame 74; uncharacterized protein C11orf74; FLJ38678; HEPIS
• Gene ID: 119710
• mRNA Refseq: NM_138787
• Protein Refseq: NP_620142
• MIM: 619270
• UniProt ID: Q86VG3