Recombinant Full Length Human HTATIP2 Protein, GST-tagged
Cat.No. : | HTATIP2-5668HF |
Product Overview : | Human HTATIP2 full-length ORF ( AAH02439, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 242 amino acids |
Description : | HTATIP2 (HIV-1 Tat Interactive Protein 2) is a Protein Coding gene. Diseases associated with HTATIP2 include Hiv-1 and Gnathodiaphyseal Dysplasia. Among its related pathways are Apoptosis and Autophagy and Cytoskeletal Signaling. GO annotations related to this gene include oxidoreductase activity and NAD binding. |
Molecular Mass : | 52.36 kDa |
AA Sequence : | MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HTATIP2 HIV-1 Tat interactive protein 2, 30kDa [ Homo sapiens ] |
Official Symbol | HTATIP2 |
Synonyms | HTATIP2; HIV-1 Tat interactive protein 2, 30kDa; HIV 1 Tat interactive protein 2, 30 kDa; oxidoreductase HTATIP2; CC3; FLJ26963; SDR44U1; short chain dehydrogenase/reductase family 44U; member 1; Tat interacting protein (30kD); TIP30; Tat-interacting protein (30kD); HIV-1 TAT-interactive protein 2; 30 kDa HIV-1 TAT-interacting protein; short chain dehydrogenase/reductase family 44U, member 1; |
Gene ID | 10553 |
mRNA Refseq | NM_001098520 |
Protein Refseq | NP_001091990 |
MIM | 605628 |
UniProt ID | Q9BUP3 |
◆ Recombinant Proteins | ||
HTATIP2-30679TH | Recombinant Human HTATIP2, His-tagged | +Inquiry |
HTATIP2-2193H | Recombinant Human HTATIP2 Protein, MYC/DDK-tagged | +Inquiry |
HTATIP2-7927M | Recombinant Mouse HTATIP2 Protein | +Inquiry |
HTATIP2-2723H | Recombinant Human HIV-1 Tat Interactive Protein 2, 30kDa, His-tagged | +Inquiry |
Htatip2-3461M | Recombinant Mouse Htatip2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTATIP2-826HCL | Recombinant Human HTATIP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HTATIP2 Products
Required fields are marked with *
My Review for All HTATIP2 Products
Required fields are marked with *
0
Inquiry Basket