Recombinant Full Length Human HSD17B1 Protein, C-Flag-tagged
Cat.No. : | HSD17B1-603HFL |
Product Overview : | Recombinant Full Length Human HSD17B1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the 17beta-hydroxysteroid dehydrogenase family of short-chain dehydrogenases/reductases. It has a dual function in estrogen activation and androgen inactivation and plays a major role in establishing the estrogen E2 concentration gradient between serum and peripheral tissues. The encoded protein catalyzes the last step in estrogen activation, using NADPH to convert estrogens E1 and E2 and androgens like 4-androstenedione, to testosterone. It has an N-terminal short-chain dehydrogenase domain with a cofactor binding site, and a narrow, hydrophobic C-terminal domain with a steroid substrate binding site. This gene is expressed primarily in the placenta and ovarian granulosa cells, and to a lesser extent, in the endometrium, adipose tissue, and prostate. Polymorphisms in this gene have been linked to breast and prostate cancer. A pseudogene of this gene has been identified. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35 kDa |
AA Sequence : | MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSLETLQLDVRDS KSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLV TGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDI HTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAM HREVFGDVPAKAEAGAEAGGGAGPGAEDEAGRGAVGDPELGDPPAAPQSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Androgen and estrogen metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | HSD17B1 hydroxysteroid 17-beta dehydrogenase 1 [ Homo sapiens (human) ] |
Official Symbol | HSD17B1 |
Synonyms | E2DH; HSD17; EDHB17; EDH17B2; SDR28C1; 17-beta-HSD; 20-alpha-HSD |
Gene ID | 3292 |
mRNA Refseq | NM_000413.4 |
Protein Refseq | NP_000404.2 |
MIM | 109684 |
UniProt ID | P14061 |
◆ Recombinant Proteins | ||
Hsd17b1-1177M | Recombinant Mouse Hsd17b1 Protein, MYC/DDK-tagged | +Inquiry |
HSD17B1-4332M | Recombinant Mouse HSD17B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD17B1-603HFL | Recombinant Full Length Human HSD17B1 Protein, C-Flag-tagged | +Inquiry |
HSD17B1-2922R | Recombinant Rat HSD17B1 Protein | +Inquiry |
HSD17B1-3290H | Recombinant Human HSD17B1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSD17B1 Products
Required fields are marked with *
My Review for All HSD17B1 Products
Required fields are marked with *
0
Inquiry Basket