Recombinant Full Length Human HS2ST1 Protein, GST-tagged

• Cat.No.: HS2ST1-3691HF
• Product Overview: Human HS2ST1 full-length ORF ( AAH25990.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation. Two alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 53.2 kDa
• Protein length: 229 amino acids
• AA Sequence: MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HS2ST1 heparan sulfate 2-O-sulfotransferase 1 [ Homo sapiens ]
• Official Symbol: HS2ST1
• Synonyms: HS2ST1; heparan sulfate 2-O-sulfotransferase 1; KIAA0448; 2OST; 2-O-sulfotransferase; dJ604K5.2; FLJ11317; MGC131986
• Gene ID: 9653
• mRNA Refseq: NM_001134492
• Protein Refseq: NP_001127964
• MIM: 604844
• UniProt ID: Q7LGA3