Recombinant Full Length Human HGD Protein, GST-tagged

• Cat.No.: HGD-3531HF
• Product Overview: Human HGD full-length ORF ( AAH20792, 1 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 329 amino acids
• Description: Homogentisate 1,2-dioxygenase (HGD) gene mutations are the molecular cause of alkaptonuria, a rare hereditary disorder of the phenylalanine catabolism. The highest expression of HGD is in the prostate, small intestine, colon, and liver. The HGD gene contains 14 exons. Conflicting reports have placed the gene at 3q2, 3q13.3-q21, 3q21-q24, 3q21-q23, or 3q25-q26. [provided by RefSeq
• Molecular Mass: 61.71 kDa
• AA Sequence: MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHLELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTALRRPARSSWHLRGLPMAPWHLCLNHL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HGD homogentisate 1,2-dioxygenase [ Homo sapiens ]
• Official Symbol: HGD
• Synonyms: HGD; homogentisate 1,2-dioxygenase; AKU, homogentisate 1,2 dioxygenase (homogentisate oxidase); HGO; homogentisate oxidase; homogentisicase; homogentisate oxygenase; homogentisic acid oxidase; AKU; FLJ94126
• Gene ID: 3081
• mRNA Refseq: NM_000187
• Protein Refseq: NP_000178
• MIM: 607474
• UniProt ID: Q93099