Recombinant Full Length Human Herv-V_19Q13.41 Provirus Ancestral Env Polyprotein 2(Ervv-2) Protein, His-Tagged
Cat.No. : | RFL26944HF |
Product Overview : | Recombinant Full Length Human HERV-V_19q13.41 provirus ancestral Env polyprotein 2(ERVV-2) Protein (B6SEH9) (22-535aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (22-535) |
Form : | Lyophilized powder |
AA Sequence : | QWNENSLVSFSKIIASGNHLSNCWICHNFITRSSSYQYILVRNFSLNLTFGSGIPEGQHK SVPLQVSLANSAHQVPCLDLTPPFNQSSKTSFYFYNCSSLNQTCCPCPEGHCDRKNTSEE GFPSPTIHPMSFSPAGCHPNLTHWCPAKQMNDYRDKSPQNRCAAWEGKELITWRVLYSLP KAHTVPTWPKSTVPLGGPLSPACNQTIPAGWKSQLHKWFDSHIPRWACTPPGYVFLCGPQ KNKLPFDGSPKITYSTPPVANLYTCINNIQHTGECAVGLLGPRGIGVTIYNTTQPRQKRA LGLILAGMGAAIGMIAPWGGFTYHDVTLRNLSRQIDNIAKSTRDSISKLKASIDSLANVV MDNRLALDYLLAEQGGVCAVINKSCCVYVNNSGAIEEDIKKIYDEATWLHDFGKGGASAR AIWEAVKSALPSLNWFVPLLGPATVILLLFLFGPCFFNLLIKCVSSRIKQFHMKSPQMER YQLSVIGGPSTYKHISPLDASGQRFRETMEEFSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERVV-2 |
Synonyms | ERVV-2; ENVV2; Endogenous retrovirus group V member 2 Env polyprotein; HERV-V_19q13.41 provirus ancestral Env polyprotein 2 |
UniProt ID | B6SEH9 |
◆ Recombinant Proteins | ||
RNASET2-6654H | Recombinant Human RNASET2 Protein (Asp25-His256), N-GST tagged | +Inquiry |
GANAB-064H | Recombinant Human glucosidase, alpha; neutral AB Protein, His tagged | +Inquiry |
HMGCL-336C | Recombinant Cynomolgus Monkey HMGCL Protein, His (Fc)-Avi-tagged | +Inquiry |
BAZ2B-61H | Recombinant Human BAZ2B protein, GST-tagged | +Inquiry |
BIN1-26316TH | Recombinant Human BIN1, His-tagged | +Inquiry |
◆ Native Proteins | ||
CA2-34R | Native Rabbit Carbonic Anhydrase II (CA2) Protein | +Inquiry |
IgM-255H | Native Human Rheumatoid Factor IgM | +Inquiry |
GG-189S | Native Sheep Gamma Globulin protein | +Inquiry |
FABP-173C | Native Canine Fatty acid Binding Protein | +Inquiry |
CA50-01H | Active Native Human Cancer Antigen 50 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Jejunum-575M | MiniPig Small Jejunum Lysate, Total Protein | +Inquiry |
SPRYD5-1686HCL | Recombinant Human SPRYD5 cell lysate | +Inquiry |
PSMC3-2763HCL | Recombinant Human PSMC3 293 Cell Lysate | +Inquiry |
IL31RA-854HCL | Recombinant Human IL31RA cell lysate | +Inquiry |
LRRFIP2-1034HCL | Recombinant Human LRRFIP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERVV-2 Products
Required fields are marked with *
My Review for All ERVV-2 Products
Required fields are marked with *
0
Inquiry Basket