Recombinant Full Length Human Herv-K_1Q23.3 Provirus Ancestral Env Polyprotein Protein, His-Tagged

• Cat.No.: RFL29193HF
• Product Overview: Recombinant Full Length Human HERV-K_1q23.3 provirus ancestral Env polyprotein Protein (O42043) (355-560aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: Full Length of Mature Protein (355-560)
• Form: Lyophilized powder
• AA Sequence: FIFTLIAVIMGLIAVTATAAVAGVALHSSVQSVNFVNYWQKNSTRLWNSQSSIDQKLASQ INDLRQTVIWMGDRLMTLEHHFQLQCDWNTSDFCITPQIYNESEHHWDMVRRHLQGREDN LTLDISKLKEQIFEASKAHLNLVPGTEAIAGVADGLANLNPVTWIKTIRSTMIINLILIV VCLFCLLLVCRCTQQLRRDSDIENGP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: ERVK-18
• Synonyms: ERVK-18; Endogenous retrovirus group K member 18 Env polyprotein; Envelope polyprotein; HERV-K(C1a envelope protein; HERV-K110 envelope protein; HERV-K18 envelope protein; HERV-K18 superantigen; HERV-K_1q23.3 provirus ancestral Env polyprotein; IDDMK1,2 2
• UniProt ID: O42043