Recombinant Full Length Human HERPUD2 Protein, GST-tagged

• Cat.No.: HERPUD2-3514HF
• Product Overview: Human HERPUD2 full-length ORF ( NP_071768.2, 1 a.a. - 406 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HERPUD2 (HERPUD Family Member 2) is a Protein Coding gene. An important paralog of this gene is HERPUD1.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 71.6 kDa
• Protein length: 406 amino acids
• AA Sequence: MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLVCTSRTPPSSPKSSTNRESHEALTSSSNSSSDHSGSTTPSSGQETLSLAVGSSSEGLRQRTLPQAQTDQAQSHQFPYVMQGNVDNQFPGQAAPPGFPVYPAFSPLQMLWWQQMYAHQYYMQYQAAVSAQATSNVNPTQPTTSQPLNLAHVPGEEPPPAPNLVAQENRPMNENVQMNAQGGPVLNEEDFNRDWLDWMYTFSRAAILLSIVYFYSSFSRFIMVMGAMLLVYLHQAGWFPFRQEGGHQQAPNNNAEVNNDGQNANNLELEEMERLMDDGLEDESGEDGGEDASAIQRPGLMASAWSFITTFFTSLIPEGPPQVAN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HERPUD2 HERPUD family member 2 [ Homo sapiens ]
• Official Symbol: HERPUD2
• Synonyms: HERPUD2; HERPUD family member 2; homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein; FLJ22313; homocysteine inducible; endoplasmic reticulum stress inducible; ubiquitin like domain member 2; homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 2; FLJ31032
• Gene ID: 64224
• mRNA Refseq: NM_022373
• Protein Refseq: NP_071768
• UniProt ID: Q9BSE4