Recombinant Full Length Human Herpesvirus 6A Glycoprotein U20(U20) Protein, His-Tagged
Cat.No. : | RFL13962HF |
Product Overview : | Recombinant Full Length Human herpesvirus 6A Glycoprotein U20(U20) Protein (Q69555) (16-422aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human Herpesvirus 6A |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (16-422) |
Form : | Lyophilized powder |
AA Sequence : | LPAKLYIKTTLAERIGKLQTVIGIDNDIVFAYERLYEDLTLLNHTVVGETLFDLTGSLEE GKNSTVDRFLGHVVIREFHRLHAGLQYVSLRNFSVSELVCFVNNNTQLSGSYVFLAGNTT YVQIDLFNENRGFVHDLINLSSFLQNRSLHVLSFYARRFCVEDILNFYGKVVFGDSRHRP PQVFSKRDTGLLVCTARRYRPIGTNIQWSIQNQTVSDDHMTDDFIRTEIAGQLLYSYERA LSRALSMTQRNFSCEITHKLLVTPALLTREDAFSFKGFVNPVKQSEDMFPRHNFPAPHRK KFNKLQLLWIFTVIPIAAGCMFVYMLTRYILFFVSGGCSLNPNRVLKRRRRNDEVPMVIM EVEYCNYEADDYMELHSVQKVRDNSIAVVCGNNSFDIERQSKISRNF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | U20 |
Synonyms | U20; EJLF3; Glycoprotein U20 |
UniProt ID | Q69555 |
◆ Recombinant Proteins | ||
RFL4810PF | Recombinant Full Length Prochlorococcus Marinus Protoheme Ix Farnesyltransferase(Ctab) Protein, His-Tagged | +Inquiry |
SAP026A-030-1615S | Recombinant Staphylococcus aureus (strain: CM05, other: ST5-MRSA-mec I) SAP026A_030 protein, His-tagged | +Inquiry |
SLCO1A2-4318R | Recombinant Rhesus monkey SLCO1A2 Protein, His-tagged | +Inquiry |
GARNL3-2380C | Recombinant Chicken GARNL3 | +Inquiry |
APLP2-6619Z | Recombinant Zebrafish APLP2 | +Inquiry |
◆ Native Proteins | ||
Complement C5a-54H | Native Human Complement C5a | +Inquiry |
IgG1-225H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
Lectin-1789G | Active Native Griffonia Simplicifolia Lectin II Protein, Fluorescein labeled | +Inquiry |
Annexin-013 | Native Annexin Protein, Gold conjugated | +Inquiry |
GPIIbIIIa-73H | Native Human GPIIbIIIa | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRK4-5738HCL | Recombinant Human GRK4 293 Cell Lysate | +Inquiry |
RASIP1-1478HCL | Recombinant Human RASIP1 cell lysate | +Inquiry |
AGPAT3-8976HCL | Recombinant Human AGPAT3 293 Cell Lysate | +Inquiry |
RPL23AP82-4332HCL | Recombinant Human MGC70863 293 Cell Lysate | +Inquiry |
LYRM2-4585HCL | Recombinant Human LYRM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All U20 Products
Required fields are marked with *
My Review for All U20 Products
Required fields are marked with *
0
Inquiry Basket