Recombinant Full Length Human Herpesvirus 1 Envelope Glycoprotein D(Gd) Protein, His-Tagged
Cat.No. : | RFL22484HF |
Product Overview : | Recombinant Full Length Human herpesvirus 1 Envelope glycoprotein D(gD) Protein (P06476) (26-393aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human Herpesvirus 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (26-393) |
Form : | Lyophilized powder |
AA Sequence : | KYALADASLKMADPNRFRGKDLPVLDQLTDPPGVRRVYHIQAGLPNPFQPPSLPITVYRR VERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSYN KSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFIL EHRAKGSCKYTLPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAGW HGPRAPYTSTLLPPELPETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQD AATPYHPPATPNNMGLIAGAVGGSLLAALVICGIVYWMRRRTRKAPKRIRLPHIREDDQP SSHQPLFY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gD |
Synonyms | gD; US6; Envelope glycoprotein D; gD |
UniProt ID | P06476 |
◆ Recombinant Proteins | ||
LRAT-6002HF | Recombinant Full Length Human LRAT Protein, GST-tagged | +Inquiry |
TDRKH-1012C | Recombinant Cynomolgus TDRKH Protein, His-tagged | +Inquiry |
IL1B-339H | Active Recombinant Human IL1B | +Inquiry |
SAP30BP-4073R | Recombinant Rhesus monkey SAP30BP Protein, His-tagged | +Inquiry |
Cul4a-2377M | Recombinant Mouse Cul4a Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-5363B | Native Bovine Albumin | +Inquiry |
Pertussis-37 | Native Pertussis Toxin Antigen | +Inquiry |
PSA-01H | Native Human PSA-ACT Complex Protein | +Inquiry |
Lectin-1774E | Active Native Erythrina Cristagalli Lectin Protein, Fluorescein labeled | +Inquiry |
APOC1-8038H | Native Human ApoLipoprotein CI | +Inquiry |
◆ Cell & Tissue Lysates | ||
H1F0-2117HCL | Recombinant Human H1F0 cell lysate | +Inquiry |
MSLN-1316HCL | Recombinant Human MSLN cell lysate | +Inquiry |
PGLYRP3-3253HCL | Recombinant Human PGLYRP3 293 Cell Lysate | +Inquiry |
RAP1A-2529HCL | Recombinant Human RAP1A 293 Cell Lysate | +Inquiry |
ANXA7-8826HCL | Recombinant Human ANXA7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gD Products
Required fields are marked with *
My Review for All gD Products
Required fields are marked with *
0
Inquiry Basket