Recombinant Full Length Human HELLS Protein
Cat.No. : | HELLS-224HF |
Product Overview : | Recombinant full length Human SMARCA6 with N-terminal proprietary tag. Predicted MW 64.39kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 348 amino acids |
Description : | This gene encodes a lymphoid-specific helicase. Other helicases function in processes involving DNA strand separation, including replication, repair, recombination, and transcription. This protein is thought to be involved with cellular proliferation and may play a role in leukemogenesis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. |
Form : | Liquid |
Molecular Mass : | 64.390kDa inclusive of tags |
AA Sequence : | MFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEK LISQIQPEVDRERAVVEVNIPVESEVNLKLQNIMMLLRKC CNHPYLIEYPIDPVTQEFKIDEELVTNSGKFLILDRMLPE LKKRGHKVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMS YSEREKNMHSFNTDPEVFIFLVSTRAGGLGINLTAADTVI IYDSDWNPQSDLQAQDRCHRIGQTKPVVVYRLVTANTIDQ KIVERAAAKRKLEKLIIHKNHFKGGQSGLNLSKNFLDPKE LMELLKSRDYEREIKGSREKVISDKDLELLLDRSDLIDQM NASGPIKEKMGIFKILENSEDSSPECLF |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | HELLS helicase, lymphoid-specific [ Homo sapiens ] |
Official Symbol | HELLS |
Synonyms | HELLS; helicase, lymphoid-specific; lymphoid-specific helicase; LSH; Nbla10143; PASG; proliferation associated SNF2 like protein; SMARCA6; SWI/SNF2 related; matrix associated; actin dependent regulator of chromatin; subfamily A; member 6 |
Gene ID | 3070 |
mRNA Refseq | NM_018063 |
Protein Refseq | NP_060533 |
MIM | 603946 |
UniProt ID | Q9NRZ9 |
◆ Recombinant Proteins | ||
HELLS-31195TH | Recombinant Human HELLS | +Inquiry |
HELLS-1885R | Recombinant Rhesus Macaque HELLS Protein, His (Fc)-Avi-tagged | +Inquiry |
HELLS-4683H | Recombinant Human HELLS Protein, GST-tagged | +Inquiry |
HELLS-13730H | Recombinant Human HELLS, GST-tagged | +Inquiry |
HELLS-3472Z | Recombinant Zebrafish HELLS | +Inquiry |
◆ Cell & Tissue Lysates | ||
HELLS-5589HCL | Recombinant Human HELLS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HELLS Products
Required fields are marked with *
My Review for All HELLS Products
Required fields are marked with *
0
Inquiry Basket