Recombinant Full Length Human HDHD2 Protein, GST-tagged

• Cat.No.: HDHD2-3443HF
• Product Overview: Human HDHD2 full-length ORF ( NP_115500.1, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HDHD2 (Haloacid Dehalogenase Like Hydrolase Domain Containing 2) is a Protein Coding gene. GO annotations related to this gene include enzyme binding. An important paralog of this gene is LHPP.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 54.9 kDa
• Protein length: 259 amino acids
• AA Sequence: MAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HDHD2 haloacid dehalogenase-like hydrolase domain containing 2 [ Homo sapiens ]
• Official Symbol: HDHD2
• Synonyms: HDHD2; haloacid dehalogenase-like hydrolase domain containing 2; haloacid dehalogenase-like hydrolase domain-containing protein 2; DKFZP564D1378; 3110052N05Rik; DKFZp564D1378
• Gene ID: 84064
• mRNA Refseq: NM_032124
• Protein Refseq: NP_115500
• UniProt ID: Q9H0R4