Recombinant Full Length Human HDAC1 Protein, GST-tagged
Cat.No. : | HDAC1-3609HF |
Product Overview : | Human HDAC1 full-length ORF ( AAH00301, 1 a.a. - 482 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 482 amino acids |
Description : | Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis. [provided by RefSeq |
Molecular Mass : | 78.76 kDa |
AA Sequence : | MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HDAC1 histone deacetylase 1 [ Homo sapiens ] |
Official Symbol | HDAC1 |
Synonyms | HDAC1; histone deacetylase 1; RPD3L1; GON 10; HD1; reduced potassium dependency, yeast homolog-like 1; RPD3; GON-10; DKFZp686H12203; |
Gene ID | 3065 |
mRNA Refseq | NM_004964 |
Protein Refseq | NP_004955 |
MIM | 601241 |
UniProt ID | Q13547 |
◆ Recombinant Proteins | ||
Hdac1-3366M | Recombinant Mouse Hdac1 Protein, Myc/DDK-tagged | +Inquiry |
HDAC1-3609HF | Recombinant Full Length Human HDAC1 Protein, GST-tagged | +Inquiry |
HDAC1-9510Z | Recombinant Zebrafish HDAC1 | +Inquiry |
HDAC1-1190HFL | Recombinant Full Length Human HDAC1 Protein, C-Flag-tagged | +Inquiry |
HDAC1-8331H | Recombinant Human HDAC1, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDAC1-5608HCL | Recombinant Human HDAC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HDAC1 Products
Required fields are marked with *
My Review for All HDAC1 Products
Required fields are marked with *
0
Inquiry Basket