Recombinant Full Length Human HBZ Protein, GST-tagged

• Cat.No.: HBZ-3502HF
• Product Overview: Human HBZ full-length ORF ( AAH27892, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 142 amino acids
• Description: Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5 - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3. [provided by RefSeq
• Molecular Mass: 41.36 kDa
• AA Sequence: MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HBZ hemoglobin, zeta [ Homo sapiens ]
• Official Symbol: HBZ
• Synonyms: HBZ; hemoglobin, zeta; hemoglobin subunit zeta; HBAZ; zeta-globin; hemoglobin zeta chain
• Gene ID: 3050
• mRNA Refseq: NM_005332
• Protein Refseq: NP_005323
• MIM: 142310
• UniProt ID: P02008