Recombinant Full Length Human HBG1 Protein, C-Flag-tagged
Cat.No. : | HBG1-62HFL |
Product Overview : | Recombinant Full Length Human HBG1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 15.9 kDa |
AA Sequence : | MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLT SLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVAS ALSSRYHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | HBG1 hemoglobin subunit gamma 1 [ Homo sapiens (human) ] |
Official Symbol | HBG1 |
Synonyms | HBGA; HBGR; HBG-T2; HSGGL1; PRO2979 |
Gene ID | 3047 |
mRNA Refseq | NM_000559.3 |
Protein Refseq | NP_000550.2 |
MIM | 142200 |
UniProt ID | P69891 |
◆ Recombinant Proteins | ||
HBG1-040H | Recombinant Human HBG1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
HBG1-1209C | Recombinant Chicken HBG1 | +Inquiry |
HBG1-4600H | Recombinant Human HBG1 Protein, GST-tagged | +Inquiry |
HBG1-20H | Recombinant Human HBG1 protein, His-Myc-tagged | +Inquiry |
HBG1-1048H | Recombinant Human HBG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBG1-5620HCL | Recombinant Human HBG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HBG1 Products
Required fields are marked with *
My Review for All HBG1 Products
Required fields are marked with *
0
Inquiry Basket