Recombinant Full Length Human HAVCR1 Protein, C-Flag-tagged
Cat.No. : | HAVCR1-1883HFL |
Product Overview : | Recombinant Full Length Human HAVCR1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a membrane receptor for both human hepatitis A virus (HHAV) and TIMD4. The encoded protein may be involved in the moderation of asthma and allergic diseases. The reference genome represents an allele that retains a MTTVP amino acid segment that confers protection against atopy in HHAV seropositive individuals. The protein is a receptor for multiple other viruses, including Ebola virus, Marburg virus, Dengue virus, and Zika virus and is a possible entry factor for SARS-CoV-2 and other coronaviruses. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.1 kDa |
AA Sequence : | MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVT YRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEIVPPKVTTTPIVTTVPT VTTVRTSTTVPTTTTVPMTTVPTTTVPTTMSIPTTTTVLTTMTVSTTTSVPTTTSIPTTTSVPVTTTVST FVPPMPLPRQNHEPVATSPSSPQPAETHPTTLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQ LFLEHSLLTANTTKGIYAGVCISVLVLLALLGVIIAKKYFFKKEVQQLSVSFSSLQIKALQNAVEKEVQA EDNIYIENSLYATD myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | HAVCR1 hepatitis A virus cellular receptor 1 [ Homo sapiens (human) ] |
Official Symbol | HAVCR1 |
Synonyms | TIM; KIM1; TIM1; CD365; HAVCR; KIM-1; TIM-1; TIMD1; TIMD-1; HAVCR-1 |
Gene ID | 26762 |
mRNA Refseq | NM_012206.3 |
Protein Refseq | NP_036338.2 |
MIM | 606518 |
UniProt ID | Q96D42 |
◆ Recombinant Proteins | ||
HAVCR1-3252H | Recombinant Human HAVCR1, Fc-His tagged | +Inquiry |
HAVCR1-13675H | Recombinant Human HAVCR1, His-tagged | +Inquiry |
Havcr1-1617R | Recombinant Rat Havcr1 Protein, His-tagged | +Inquiry |
HAVCR1-2326C | Recombinant Chicken HAVCR1 | +Inquiry |
HAVCR1-0264H | Recombinant Human HAVCR1 protein, His&Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAVCR1-2141HCL | Recombinant Human HAVCR1 cell lysate | +Inquiry |
HAVCR1-2486CCL | Recombinant Canine HAVCR1 cell lysate | +Inquiry |
HAVCR1-2297MCL | Recombinant Mouse HAVCR1 cell lysate | +Inquiry |
HAVCR1-2394RCL | Recombinant Rat HAVCR1 cell lysate | +Inquiry |
HAVCR1-2003CCL | Recombinant Cynomolgus HAVCR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HAVCR1 Products
Required fields are marked with *
My Review for All HAVCR1 Products
Required fields are marked with *
0
Inquiry Basket