Recombinant Full Length Human HAVCR1 Protein, C-Flag-tagged

• Cat.No.: HAVCR1-1883HFL
• Product Overview: Recombinant Full Length Human HAVCR1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: The protein encoded by this gene is a membrane receptor for both human hepatitis A virus (HHAV) and TIMD4. The encoded protein may be involved in the moderation of asthma and allergic diseases. The reference genome represents an allele that retains a MTTVP amino acid segment that confers protection against atopy in HHAV seropositive individuals. The protein is a receptor for multiple other viruses, including Ebola virus, Marburg virus, Dengue virus, and Zika virus and is a possible entry factor for SARS-CoV-2 and other coronaviruses.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 37.1 kDa
• AA Sequence: MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVT YRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEIVPPKVTTTPIVTTVPT VTTVRTSTTVPTTTTVPMTTVPTTTVPTTMSIPTTTTVLTTMTVSTTTSVPTTTSIPTTTSVPVTTTVST FVPPMPLPRQNHEPVATSPSSPQPAETHPTTLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQ LFLEHSLLTANTTKGIYAGVCISVLVLLALLGVIIAKKYFFKKEVQQLSVSFSSLQIKALQNAVEKEVQA EDNIYIENSLYATD myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Transmembrane
• Full Length: Full L.

Gene Information

• Gene Name: HAVCR1 hepatitis A virus cellular receptor 1 [ Homo sapiens (human) ]
• Official Symbol: HAVCR1
• Synonyms: TIM; KIM1; TIM1; CD365; HAVCR; KIM-1; TIM-1; TIMD1; TIMD-1; HAVCR-1
• Gene ID: 26762
• mRNA Refseq: NM_012206.3
• Protein Refseq: NP_036338.2
• MIM: 606518
• UniProt ID: Q96D42