Recombinant Full Length Human HAS3 Protein, GST-tagged

• Cat.No.: HAS3-3484HF
• Product Overview: Human HAS3 full-length ORF ( AAH21853, 1 a.a. - 281 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 281 amino acids
• Description: The protein encoded by this gene is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. This gene is a member of the NODC/HAS gene family. Compared to the proteins encoded by other members of this gene family, this protein appears to be more of a regulator of hyaluronan synthesis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• Molecular Mass: 56.65 kDa
• AA Sequence: MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQSLFAFLEHRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HAS3 hyaluronan synthase 3 [ Homo sapiens (human) ]
• Official Symbol: HAS3
• Synonyms: HAS3; hyaluronan synthase 3; hyaluronan synthase 3; HA synthase 3; hyaluronate synthase 3; hyaluronic acid synthase 3; EC 2.4.1.212
• Gene ID: 3038
• mRNA Refseq: NM_001199280
• Protein Refseq: NP_001186209
• MIM: 602428
• UniProt ID: O00219