Recombinant Full Length Human HARBI1 Protein, GST-tagged
Cat.No. : | HARBI1-3409HF |
Product Overview : | Human HARBI1 full-length ORF (BAB71391.1, 1 a.a. - 349 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 349 amino acids |
Description : | HARBI1 (Harbinger Transposase Derived 1) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity, acting on ester bonds and nuclease activity. |
Molecular Mass : | 65.5 kDa |
AA Sequence : | MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYYLVELLGANLSRPTQRSRAISPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIRFPADEASIQALKDEFYGLAGMPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGALQYSPEKSSHIILACCVLHNISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELMLTHFS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HARBI1 harbinger transposase derived 1 [ Homo sapiens ] |
Official Symbol | HARBI1 |
Synonyms | HARBI1; harbinger transposase derived 1; C11orf77, chromosome 11 open reading frame 77; putative nuclease HARBI1; FLJ32675; harbinger transposase-derived nuclease; C11orf77; |
Gene ID | 283254 |
mRNA Refseq | NM_173811 |
Protein Refseq | NP_776172 |
MIM | 615086 |
UniProt ID | Q96MB7 |
◆ Recombinant Proteins | ||
HARBI1-2445R | Recombinant Rat HARBI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HARBI1-3096H | Recombinant Human HARBI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HARBI1-1857R | Recombinant Rhesus Macaque HARBI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HARBI1-2791R | Recombinant Rat HARBI1 Protein | +Inquiry |
HARBI1-1502H | Recombinant Human HARBI1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HARBI1-5635HCL | Recombinant Human HARBI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HARBI1 Products
Required fields are marked with *
My Review for All HARBI1 Products
Required fields are marked with *
0
Inquiry Basket