Recombinant Full Length Human H2AFZ Protein, GST-tagged

• Cat.No.: H2AFZ-3406HF
• Product Overview: Human H2AFZ full-length ORF ( AAH18002, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 39.82 kDa
• Protein length: 128 amino acids
• AA Sequence: MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: H2AFZ H2A histone family, member Z [ Homo sapiens ]
• Official Symbol: H2AFZ
• Synonyms: H2AFZ; H2A histone family, member Z; H2AZ; histone H2A.Z; H2A.Z; H2AZ histone; H2A.z; H2A/z; MGC117173
• Gene ID: 3015
• mRNA Refseq: NM_002106
• Protein Refseq: NP_002097
• MIM: 142763
• UniProt ID: P0C0S5