Recombinant Full Length Human H2AFZ Protein, GST-tagged
Cat.No. : | H2AFZ-3406HF |
Product Overview : | Human H2AFZ full-length ORF ( AAH18002, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 128 amino acids |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality. [provided by RefSeq |
Molecular Mass : | 39.82 kDa |
AA Sequence : | MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | H2AFZ H2A histone family, member Z [ Homo sapiens ] |
Official Symbol | H2AFZ |
Synonyms | H2AFZ; H2A histone family, member Z; H2AZ; histone H2A.Z; H2A.Z; H2AZ histone; H2A.z; H2A/z; MGC117173; |
Gene ID | 3015 |
mRNA Refseq | NM_002106 |
Protein Refseq | NP_002097 |
MIM | 142763 |
UniProt ID | P0C0S5 |
◆ Recombinant Proteins | ||
H2AFZ-7949Z | Recombinant Zebrafish H2AFZ | +Inquiry |
H2AFZ-7432M | Recombinant Mouse H2AFZ Protein | +Inquiry |
H2AFZ-3406HF | Recombinant Full Length Human H2AFZ Protein, GST-tagged | +Inquiry |
H2AFZ-5116H | Recombinant Human H2AFZ, His-tagged | +Inquiry |
H2AFZ-2431R | Recombinant Rat H2AFZ Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
H2AFZ-5655HCL | Recombinant Human H2AFZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All H2AFZ Products
Required fields are marked with *
My Review for All H2AFZ Products
Required fields are marked with *
0
Inquiry Basket