Recombinant Full Length Human H2AFY2 Protein, GST-tagged

• Cat.No.: H2AFY2-3405HF
• Product Overview: Human H2AFY2 full-length ORF ( NP_061119.1, 1 a.a. - 372 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and may participate in stable X chromosome inactivation. [provided by RefSeq, Oct 2015]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 66.5 kDa
• Protein length: 372 amino acids
• AA Sequence: MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDAK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: H2AFY2 H2A histone family, member Y2 [ Homo sapiens ]
• Official Symbol: H2AFY2
• Synonyms: H2AFY2; H2A histone family, member Y2; core histone macro-H2A.2; macroH2A2; mH2A2; histone macroH2A2; core histone macroH2A2.2
• Gene ID: 55506
• mRNA Refseq: NM_018649
• Protein Refseq: NP_061119
• MIM: 616141
• UniProt ID: Q9P0M6