Recombinant Full Length Human H2AFJ Protein, GST-tagged

• Cat.No.: H2AFJ-3402HF
• Product Overview: Human H2AFJ full-length ORF (BAA91894.1, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is located on chromosome 12 and encodes a variant H2A histone. The protein is divergent at the C-terminus compared to the consensus H2A histone family member. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 42.5 kDa
• Protein length: 151 amino acids
• AA Sequence: MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPVCEHSGPSSGKIPSDRAELGAGSVCGHIFQKVE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: H2AFJ H2A histone family, member J [ Homo sapiens ]
• Official Symbol: H2AFJ
• Synonyms: H2A histone family, member J; 14456; Ensembl:ENSG00000246705; MGC921, FLJ10903, FLJ52230; histone H2A.J;H2a/j; H2AJ
• Gene ID: 55766
• mRNA Refseq: NM_177925
• Protein Refseq: NP_808760
• UniProt ID: Q9BTM1