Recombinant Full Length Human GTSF1 Protein, GST-tagged

Cat.No. : GTSF1-3339HF
Product Overview : Human GTSF1 full-length ORF ( NP_653195.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 167 amino acids
Description : GTSF1 (Gametocyte Specific Factor 1) is a Protein Coding gene. An important paralog of this gene is GTSF1L.
Molecular Mass : 45.6 kDa
AA Sequence : MEETYTDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSCIEQDVVNQTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFAWGTTHYSDNNSPASNIVTEHKNNLASGMRVPKSLPYVLPWKNNGNAQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GTSF1 gametocyte specific factor 1 [ Homo sapiens ]
Official Symbol GTSF1
Synonyms GTSF1; gametocyte specific factor 1; FAM112B, family with sequence similarity 112, member B; gametocyte-specific factor 1; FLJ32942; family with sequence similarity 112, member B; FAM112B;
Gene ID 121355
mRNA Refseq NM_144594
Protein Refseq NP_653195
MIM 617484
UniProt ID Q8WW33

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GTSF1 Products

Required fields are marked with *

My Review for All GTSF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon