Recombinant Full Length Human GTPBP1 Protein, GST-tagged
Cat.No. : | GTPBP1-3421HF |
Product Overview : | Human GTPBP1 full-length ORF ( ENSP00000334787, 1 a.a. - 584 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 584 amino acids |
Description : | This gene is upregulated by interferon-gamma and encodes a protein that is a member of the AGP11/GTPBP1 family of GTP-binding proteins. A structurally similar protein has been found in mouse, where disruption of the gene for that protein had no observable phenotype. [provided by RefSeq |
Molecular Mass : | 89.8 kDa |
AA Sequence : | MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSLEWTKICEKSTKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDDVIVTASNFSSERMCPIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTLRGLIKLNDTLLLGPDPLGNFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQTTNNSPMNSKPQQIKMQSTKKGPLTKRDEGGPSGGPAVGAPPPGDEASSVGAGQPAASSNLQPQPKPSSGGRRRGGQRHKVKSQGACVTPASGC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GTPBP1 GTP binding protein 1 [ Homo sapiens ] |
Official Symbol | GTPBP1 |
Synonyms | GTPBP1; GTP binding protein 1; GTP-binding protein 1; GP 1; HSPC018; G-protein 1; GP1; GP-1; MGC20069; |
Gene ID | 9567 |
mRNA Refseq | NM_004286 |
Protein Refseq | NP_004277 |
MIM | 602245 |
UniProt ID | O00178 |
◆ Recombinant Proteins | ||
GTPBP1-2403R | Recombinant Rat GTPBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GTPBP1-13606H | Recombinant Human GTPBP1, GST-tagged | +Inquiry |
GTPBP1-2014R | Recombinant Rhesus monkey GTPBP1 Protein, His-tagged | +Inquiry |
GTPBP1-2749R | Recombinant Rat GTPBP1 Protein | +Inquiry |
GTPBP1-12642Z | Recombinant Zebrafish GTPBP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTPBP1-5687HCL | Recombinant Human GTPBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GTPBP1 Products
Required fields are marked with *
My Review for All GTPBP1 Products
Required fields are marked with *
0
Inquiry Basket