Recombinant Full Length Human GSTT2 Protein, GST-tagged

• Cat.No.: GSTT2-3369HF
• Product Overview: Human GSTT2 full-length ORF ( AAH02415, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Glutathione S-transferase (GSTs) theta 2 (GSTT2) is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: Alpha, Mu, Pi, Theta, and Zeta. The theta class members GSTT1 and GSTT2 share 55% amino acid sequence identity and both are thought to have an important role in human carcinogenesis. The theta genes have a similar structure, being composed of five exons with identical exon/intron boundaries. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 52.58 kDa
• Protein length: 244 amino acids
• AA Sequence: MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GSTT2 glutathione S-transferase theta 2 [ Homo sapiens ]
• Official Symbol: GSTT2
• Synonyms: GSTT2; glutathione S-transferase theta 2; glutathione S-transferase theta-2; GST class-theta-2; Glutathione S-transferase theta-2B; GSTT2B; MGC182032
• Gene ID: 2953
• mRNA Refseq: NM_000854
• Protein Refseq: NP_000845
• MIM: 600437
• UniProt ID: P0CG29