Recombinant Full Length Human GPSM3 Protein, GST-tagged

• Cat.No.: GPSM3-5568HF
• Product Overview: Human GPSM3 full-length ORF ( AAH18724, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GPSM3 (G Protein Signaling Modulator 3) is a Protein Coding gene. Diseases associated with GPSM3 include Prostate Leiomyosarcoma and Griscelli Syndrome, Type 1. GO annotations related to this gene include GTPase regulator activity and GDP-dissociation inhibitor activity.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 43.34 kDa
• Protein length: 160 amino acids
• AA Sequence: MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSLQTELLLDLVAEAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPSM3 G-protein signaling modulator 3 [ Homo sapiens ]
• Official Symbol: GPSM3
• Synonyms: GPSM3; G-protein signaling modulator 3; C6orf9, chromosome 6 open reading frame 9, G protein signalling modulator 3 (AGS3 like, C. elegans); G-protein-signaling modulator 3; activator of G protein signaling 4; AGS4; G18; G18.1a; G18.1b; G18.2; NG1; activator of G-protein signaling 4; G-protein signaling modulator 3 (AGS3-like, C. elegans); G-protein signalling modulator 3 (AGS3-like, C. elegans); C6orf9
• Gene ID: 63940
• mRNA Refseq: NM_022107
• Protein Refseq: NP_071390
• MIM: 618558
• UniProt ID: Q9Y4H4