Recombinant Full Length Human GPR17 Protein, GST-tagged

• Cat.No.: GPR17-5479HF
• Product Overview: Human GPR17 full-length ORF ( AAH31653, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 339 amino acids
• Description: GPR17 (G Protein-Coupled Receptor 17) is a Protein Coding gene. Diseases associated with GPR17 include Suppression Amblyopia. Among its related pathways are Nucleotide-like (purinergic) receptors and RET signaling. GO annotations related to this gene include G-protein coupled receptor activity and chemokine receptor activity. An important paralog of this gene is P2RY4.
• Molecular Mass: 63.03 kDa
• AA Sequence: MNGLEVAPPGLITNFSLATAEQCGQETPLENMLFASFYLLDFILALVGNTLALWFFIRDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHFSGNHWPFGEIACRLTGFLFYLNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLACAFLWVVVAVAMAPLLVSPQTVQTNHTVVCLQLYREKASHHALVSLAVAFTFPFITTVTCYLLIIRSLRQGLRVEKRLKTKAVRMIAIVLAIFLVCFVPYHVNRSVYVLHYRSHGASCATQRILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNLLCGKRLKGPPPSFEGKTNESSLSAKSEL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPR17 G protein-coupled receptor 17 [ Homo sapiens ]
• Official Symbol: GPR17
• Synonyms: GPR17; G protein-coupled receptor 17; uracil nucleotide/cysteinyl leukotriene receptor; R12; P2Y-like receptor; UDP/CysLT receptor; G-protein coupled receptor 17; DKFZp686M18273
• Gene ID: 2840
• mRNA Refseq: NM_001161415
• Protein Refseq: NP_001154887
• MIM: 603071
• UniProt ID: Q13304