Recombinant Full Length Human GNRH1 Protein, C-Flag-tagged

• Cat.No.: GNRH1-1845HFL
• Product Overview: Recombinant Full Length Human GNRH1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 7.8 kDa
• AA Sequence: MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS PLRDLKGALESLIEEETGQKKI myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: GnRH signaling pathway
• Full Length: Full L.

Gene Information

• Gene Name: GNRH1 gonadotropin releasing hormone 1 [ Homo sapiens (human) ]
• Official Symbol: GNRH1
• Synonyms: GRH; GNRH; LHRH; LNRH
• Gene ID: 2796
• mRNA Refseq: NM_000825.3
• Protein Refseq: NP_000816.4
• MIM: 152760
• UniProt ID: P01148