Recombinant Full Length Human GNG5 Protein, GST-tagged
Cat.No. : | GNG5-5390HF |
Product Overview : | Human GNG5 full-length ORF ( AAH03563, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 68 amino acids |
Description : | G proteins are trimeric (alpha-beta-gamma) membrane-associated proteins that regulate flow of information from cell surface receptors to a variety of internal metabolic effectors. Interaction of a G protein with its activated receptor promotes exchange of GTP for GDP that is bound to the alpha subunit. The alpha-GTP complex dissociates from the beta-gamma heterodimer so that the subunits, in turn, may interact with and regulate effector molecules (Gilman, 1987 [PubMed 3113327]; summary by Ahmad et al., 1995) [PubMed 7606925].[supplied by OMIM, Nov 2010] |
Molecular Mass : | 33.22 kDa |
AA Sequence : | MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNG5 guanine nucleotide binding protein (G protein), gamma 5 [ Homo sapiens ] |
Official Symbol | GNG5 |
Synonyms | GNG5; guanine nucleotide binding protein (G protein), gamma 5; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5; FLJ92393; |
Gene ID | 2787 |
mRNA Refseq | NM_005274 |
Protein Refseq | NP_005265 |
MIM | 600874 |
UniProt ID | P63218 |
◆ Recombinant Proteins | ||
GNG5-13365H | Recombinant Human GNG5, GST-tagged | +Inquiry |
GNG5-2262R | Recombinant Rat GNG5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNG5-6089H | Recombinant Human GNG5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GNG5-2607R | Recombinant Rat GNG5 Protein | +Inquiry |
GNG5-5071H | Recombinant Human GNG5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNG5-5851HCL | Recombinant Human GNG5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNG5 Products
Required fields are marked with *
My Review for All GNG5 Products
Required fields are marked with *
0
Inquiry Basket