Recombinant Full Length Human GNB5 Protein, GST-tagged

• Cat.No.: GNB5-5372HF
• Product Overview: Human GNB5 full-length ORF ( AAH11671, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. Alternatively spliced transcript variants encoding different isoforms exist. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 39.6 kDa
• Protein length: 126 amino acids
• AA Sequence: MATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKVRHCSQPRYRGFRIPAYLKVLWSSCPALS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GNB5 guanine nucleotide binding protein (G protein), beta 5 [ Homo sapiens ]
• Official Symbol: GNB5
• Synonyms: GNB5; guanine nucleotide binding protein (G protein), beta 5; guanine nucleotide-binding protein subunit beta-5; GB5; gbeta5; transducin beta chain 5; G protein, beta-5 subunit; G protein, beta subunit 5L; guanine nucleotide-binding protein, beta subunit 5L; FLJ37457; FLJ43714
• Gene ID: 10681
• mRNA Refseq: NM_006578
• Protein Refseq: NP_006569
• MIM: 604447
• UniProt ID: O14775