Recombinant Full Length Human GNA11 Protein, GST-tagged

• Cat.No.: GNA11-6939HF
• Product Overview: Recombinant Human full-length GNA11(1 a.a. - 359 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 359 amino acids
• Description: The protein encoded by this gene belongs to the family of guanine nucleotide-binding proteins (G proteins), which function as modulators or transducers in various transmembrane signaling systems. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes one of the alpha subunits (subunit alpha-11). Mutations in this gene have been associated with hypocalciuric hypercalcemia type II (HHC2) and hypocalcemia dominant 2 (HYPOC2). Patients with HHC2 and HYPOC2 exhibit decreased or increased sensitivity, respectively, to changes in extracellular calcium concentrations.
• Molecular Mass: 68.5 kDa
• AA Sequence: MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEEDKRGF TKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEKVTTFEHQYVSAIKTLWEDPGIQECYDRRRE YQLSDSAKYYLTDVDRIATLGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTS IMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQR DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GNA11 guanine nucleotide binding protein (G protein), alpha 11 (Gq class) [ Homo sapiens (human) ]
• Official Symbol: GNA11
• Synonyms: GNA11; FBH; FBH2; FHH2; HHC2; GNA-11; HYPOC2; guanine nucleotide binding protein (G protein), alpha 11 (Gq class); guanine nucleotide-binding protein subunit alpha-11; g alpha-11; G-protein subunit alpha-11; guanine nucleotide-binding protein G(y) subunit alpha
• Gene ID: 2767
• mRNA Refseq: NM_002067
• Protein Refseq: NP_002058
• MIM: 139313
• UniProt ID: P29992