Recombinant Full Length Human Glycerol-3-Phosphate Acyltransferase 4(Agpat6) Protein, His-Tagged
Cat.No. : | RFL830HF |
Product Overview : | Recombinant Full Length Human Glycerol-3-phosphate acyltransferase 4(AGPAT6) Protein (Q86UL3) (38-456aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (38-456) |
Form : | Lyophilized powder |
AA Sequence : | VSFGIRKLYMKSLLKIFAWATLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRR SGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYIS LRLTVLWGLGVLIRYCFLLPLRIALAFTGISLLVVGTTVVGYLPNGRFKEFMSKHVHLMC YRICVRALTAIITYHDRENRPRNGGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVI QRAMVKACPHVWFERSEVKDRHLVAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKG SFEIGATVYPVAIKYDPQFGDAFWNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTREADE DAVQFANRVKSAIARQGGLVDLLWDGGLKREKVKDTFKEEQQKLYSKMIVGNHKDRSRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPAT4 |
Synonyms | GPAT4; AGPAT6; TSARG7; UNQ551/PRO1108; Glycerol-3-phosphate acyltransferase 4; 1-acylglycerol-3-phosphate O-acyltransferase 6; 1-AGP acyltransferase 6; 1-AGPAT 6; Acyl-CoA:glycerol-3-phosphate acyltransferase 4; Lysophosphatidic acid acyltransferase zeta; |
UniProt ID | Q86UL3 |
◆ Recombinant Proteins | ||
EPB41L3B-12822Z | Recombinant Zebrafish EPB41L3B | +Inquiry |
IgG2aFc-961M | Recombinant Mouse IgG2aFc protein | +Inquiry |
GABRA1-4685Z | Recombinant Zebrafish GABRA1 | +Inquiry |
CCNB3-6792C | Recombinant Chicken CCNB3 | +Inquiry |
PRKAA2-7084M | Recombinant Mouse PRKAA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PSMA3-419S | Active Native S. aureus PSM-alpha 3 protein | +Inquiry |
F13A1-1881H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
PLG-30879TH | Native Human PLG | +Inquiry |
LTF-8196H | Native Human Breast Milk Lactoferrin APO | +Inquiry |
PGC-8318H | Native Human PGC | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP4C-494HCL | Recombinant Human PPP4C lysate | +Inquiry |
ABCC3-9150HCL | Recombinant Human ABCC3 293 Cell Lysate | +Inquiry |
GCK-5985HCL | Recombinant Human GCK 293 Cell Lysate | +Inquiry |
UPP1-494HCL | Recombinant Human UPP1 293 Cell Lysate | +Inquiry |
CSTA-7225HCL | Recombinant Human CSTA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPAT4 Products
Required fields are marked with *
My Review for All GPAT4 Products
Required fields are marked with *
0
Inquiry Basket